PDB entry 5ojw

View 5ojw on RCSB PDB site
Description: S. cerevisiae UBC13 - MMs2 complex
Class: signaling protein
Keywords: E2, Ubiquitin, complex, SIGNALING PROTEIN
Deposited on 2017-07-24, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC13, YDR092W, YD6652.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ojwa_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme variant MMS2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MMS2, YGL087C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ojwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ojwA (A:)
    maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
    dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
    landvaedwikneqgakakarewtklyakkkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ojwB (B:)
    mskvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysl
    sidcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkem
    atpankklrqpkegetf