PDB entry 5ojw

View 5ojw on RCSB PDB site
Description: S. cerevisiae UBC13 - MMs2 complex
Class: signaling protein
Keywords: E2, Ubiquitin, complex, SIGNALING PROTEIN
Deposited on 2017-07-24, released 2017-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-conjugating enzyme E2 13
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: UBC13, YDR092W, YD6652.04
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52490 (0-151)
  Domains in SCOPe 2.08: d5ojwa_
• Chain 'B':
  Compound: Ubiquitin-conjugating enzyme variant MMS2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: MMS2, YGL087C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53152 (0-136)
  Domains in SCOPe 2.08: d5ojwb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ojwA (A:)
  maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
  dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
  landvaedwikneqgakakarewtklyakkkp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ojwB (B:)
  mskvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysl
  sidcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkem
  atpankklrqpkegetf