PDB entry 5ojn

View 5ojn on RCSB PDB site
Description: Sirtuin 4 from Xenopus tropicalis in complex with thioacetyl-ADP-ribose
Class: signaling protein
Keywords: Sirtuin, Sirt4, Deacylase, Mitochondria, SIGNALING PROTEIN
Deposited on 2017-07-22, released 2017-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent protein deacylase
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: sirt4, TGas015j14.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28CB4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5ojna1, d5ojna2
  • Heterogens: 9X8, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ojnA (A:)
    hmvpacpppnphqveqlqdfvsqsqrlfvmtgagistesgipdyrsegvglysrterrpi
    qhsefvqsqaarrrywarnfvgwpsfsshepnsahvnlckweragrlhwlvtqnvdalht
    kagqcrlselhgcthrviclgcqtvtkrselqerflnlnpswneqahglapdgdvfltde
    qvsdfqvpactkcggilkpqvtffgdtvnrgfvfsiyeqmkqadamlivgsslqvysgyr
    falnakelhlpiailnigptradhlakvkvsarcgdvlphillqdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ojnA (A:)
    hmvpacpppnphqveqlqdfvsqsqrlfvmtgagistesgipdyrsegvglysrterrpi
    qhsefvqsqaarrrywarnfvgwpsfsshepnsahvnlckweragrlhwlvtqnvdalht
    kagqcrlselhgcthrviclgcqtvtkrselqerflnlnpswneltdeqvsdfqvpactk
    cggilkpqvtffgdtvnrgfvfsiyeqmkqadamlivgsslqvysgyrfalnakelhlpi
    ailnigptradhlakvkvsarcgdvlphillq