PDB entry 5oj7

View 5oj7 on RCSB PDB site
Description: Sirtuin 4 orthologue from Xenopus Tropicalis in complex with ADP-ribose
Class: hydrolase
Keywords: Sirt4 Deacylase Posttranslational modification, HYDROLASE
Deposited on 2017-07-20, released 2017-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent protein deacylase
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: sirt4, TGas015j14.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28CB4 (2-285)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5oj7a1, d5oj7a2
  • Heterogens: AR6, ZN, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5oj7A (A:)
hmvpacpppnphqveqlqdfvsqsqrlfvmtgagistesgipdyrsegvglysrterrpi
qhsefvqsqaarrrywarnfvgwpsfsshepnsahvnlckweragrlhwlvtqnvdalht
kagqcrlselhgcthrviclgcqtvtkrselqerflnlnpswneqahglapdgdvfltde
qvsdfqvpactkcggilkpqvtffgdtvnrgfvfsiyeqmkqadamlivgsslqvysgyr
falnakelhlpiailnigptradhlakvkvsarcgdvlphillqdq