PDB entry 5oj1

View 5oj1 on RCSB PDB site
Description: Penicillin Binding Protein 2x (PBP2x) from S.pneumoniae in complex with Oxacillin and a tetrasaccharide
Class: antibiotic
Keywords: Penicillin-binding-protein, cell-wall, ANTIBIOTIC
Deposited on 2017-07-20, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 2x
    Species: STREPTOCOCCUS PNEUMONIAE R6 [TaxId:171101]
    Gene: pbpX, spr0304
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oj1a1, d5oj1a2, d5oj1a3, d5oj1a4
  • Heterogens: 1S6, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oj1A (A:)
    gtgtrfgtdlakeakkvhqttrtvpakrgtiydrngvpiaedatsynvyavidenyksat
    gkilyvektqfnkvaevfhkyldmeesyvreqlsqpnlkqvsfgakgngityanmmsikk
    eleaaevkgidfttspnrsypngqfassfiglaqlhenedgsksllgtsgmesslnsila
    gtdgiityekdrlgnivpgteqvsqrtmdgkdvyttissplqsfmetqmdafqekvkgky
    mtatlvsaktgeilattqrptfdadtkegitedfvwrdilyqsnyepgstmkvmmlaaai
    dnntfpggevfnsselkiadatirdwdvnegltggrmmtfsqgfahssnvgmtlleqkmg
    datwldylnrfkfgvptrfgltdeyagqlpadnivniaqssfgqgisvtqtqmiraftai
    andgvmlepkfisaiydpndqtarksqkeivgnpvskdaasltrtnmvlvgtdpvygtmy
    nhstgkptvtvpgqnvalksgtaqiadeknggylvgltdyifsavsmspaenpdfilyvt
    vqqpehysgiqlgefanpilerasamkdslnlqttakaleqvsqqspypmpsvkdispgd
    laeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsdkaeevpdmygwtketae
    tlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oj1A (A:)
    vpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyld
    meesyvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypng
    qfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiitylgnivpgteqvsqrt
    mdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtk
    egitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwd
    vnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyag
    qlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksq
    keivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiad
    eknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamk
    dslnlqttakaleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssae
    egknlapnqqvlilsdkaeevpdmygwtketaetlakwlnielefqgsgstvqkqdvran
    taikdikkitltlgd