PDB entry 5oih

View 5oih on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
Class: signaling protein
Keywords: pdz domain, SIGNALING PROTEIN
Deposited on 2017-07-18, released 2018-08-08
Made obsolete by 6qjk on 2019-04-17

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-97)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d5oiha_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oihA (A:)
    edipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oihA (A:)
    dipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngv
    dlrnasheqaaialknagqtvtiiaqykpeeysrfea