PDB entry 5oib

View 5oib on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
Class: signaling protein
Keywords: pdz domain, SIGNALING PROTEIN
Deposited on 2017-07-18, released 2018-08-08
Made obsolete by 6qji on 2019-04-17

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oiba_
  • Chain 'B':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oibb_
  • Chain 'C':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oibc_
  • Chain 'D':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oibd_
  • Chain 'E':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oibe_
  • Chain 'F':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oibf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oibA (A:)
    edipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oibA (A:)
    prrivihrgglgfnivggedegifisfilaggpadlsgelrkgdqilsvngvdlrnashe
    qaaialknagqtvtiiaqykpeeysr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oibB (B:)
    edipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oibB (B:)
    eprrivihrglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlrnash
    eqaaialknagqtvtiiaqykpeeysrfea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oibC (C:)
    edipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oibC (C:)
    reprrivihrglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlrnas
    heqaaialknagqtvtiiaqykpeeysrf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oibD (D:)
    edipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oibD (D:)
    eprrivihrgsglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlrna
    sheqaaialknagqtvtiiaqykpeeysrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oibE (E:)
    edipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oibE (E:)
    reprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlr
    nasheqaaialknagqtvtiiaqykpeeysrfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5oibF (F:)
    edipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oibF (F:)
    eprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlrn
    asheqaaialknagqtvtiiaqykpeeysrfeak