PDB entry 5oi8

View 5oi8 on RCSB PDB site
Description: Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
Class: viral protein
Keywords: HIV-1, Integrase, Catalytic core domain, VIRAL PROTEIN
Deposited on 2017-07-18, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot I0BY59
      • conflict (93)
      • conflict (154)
      • conflict (175)
    Domains in SCOPe 2.07: d5oi8a_
  • Heterogens: MG, 9VN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oi8A (A:)
    mgsshhhhhhssglvprgsmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevip
    aetgqetayfllklagrwpvktvhtdngsnftsaavkaacwwagikqefgipynpqsqgv
    vesmnkelkkiigqvrdqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqt
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oi8A (A:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
    ngsnftsaavkaacwwagikqmnkelkkiigqvrdqaehlktavqmavfihnkkrkysag
    erivdiiatdi