PDB entry 5oi6

View 5oi6 on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group C121, structure 2
Class: signaling protein
Keywords: pdz domain, SIGNALING PROTEIN
Deposited on 2017-07-18, released 2018-08-08
Made obsolete by 6qjg on 2019-04-17

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5oi6a_
  • Chain 'B':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5oi6b_
  • Chain 'C':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-103)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5oi6c_
  • Chain 'D':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-103)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5oi6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oi6A (A:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oi6A (A:)
    dipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngv
    dlrnasheqaaialknagqtvtiiaqykpeeysrfea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oi6B (B:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oi6B (B:)
    ipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngvd
    lrnasheqaaialknagqtvtiiaqykpeeysrfea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oi6C (C:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oi6C (C:)
    dipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngv
    dlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oi6D (D:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oi6D (D:)
    ipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngvd
    lrnasheqaaialknagqtvtiiaqykpeeysrfeak