PDB entry 5oi4

View 5oi4 on RCSB PDB site
Description: crystal structure of the third pdz domain of psd-95 protein d332p mutant: space group c121, structure 1
Deposited on 2017-07-18, released 2018-08-08
Made obsolete by 6qjf on 2019-04-17

The last revision was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-103)
      • engineered mutation (32)
  • Chain 'B':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-103)
      • engineered mutation (32)
  • Chain 'C':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-103)
      • engineered mutation (32)
  • Chain 'D':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (Start-103)
      • engineered mutation (32)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5oi4A (A:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records):
    >5oi4A (A:)
    ipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngvd
    lrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5oi4B (B:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records):
    >5oi4B (B:)
    edipreprrivihrgsglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngv
    dlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5oi4C (C:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records):
    >5oi4C (C:)
    dipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngv
    dlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5oi4D (D:)
    mglgeedipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records):
    >5oi4D (D:)
    reprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngvdlr
    nasheqaaialknagqtvtiiaqykpeeysrfeak