PDB entry 5oi3

View 5oi3 on RCSB PDB site
Description: Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
Class: viral protein
Keywords: HIV-1, Integrase, Catalytic core domain, VIRAL PROTEIN
Deposited on 2017-07-18, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9VID1
      • engineered mutation (94)
      • conflict (154)
    Domains in SCOPe 2.08: d5oi3a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oi3A (A:)
    mgsshhhhhhssglvprgsmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevip
    aetgqetayfllklagrwpvktvhtdngsnftsaavkaacwwagikqefgipynpqsqgv
    vesmnkelkkiigqvrdqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqt
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oi3A (A:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
    ngsnftsaavkaacwwagikqmnkelkkiigqvrdqaehlktavqmavfihnkkrkysag
    erivdiiatdi