PDB entry 5ogu

View 5ogu on RCSB PDB site
Description: Structure of DNA-binding HU protein from micoplasma Spiroplasma melliferum
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2017-07-13, released 2017-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein
  Species: Spiroplasma melliferum KC3 [TaxId:570509]
  Gene: SPM_000560
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A037USE5 (2-94)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d5ogua1, d5ogua2
• Chain 'B':
  Compound: DNA-binding protein
  Species: Spiroplasma melliferum KC3 [TaxId:570509]
  Gene: SPM_000560
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A037USE5 (2-94)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d5ogub1, d5ogub2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5oguA (A:)
  ghmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
  ardgrnpstgetikipasksakfkagkqlktdlnn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5oguB (B:)
  ghmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
  ardgrnpstgetikipasksakfkagkqlktdlnn