PDB entry 5ogt

View 5ogt on RCSB PDB site
Description: Thermus scotoductus SA-01 Ene-reductase triple mutant TsER_C25D_I67T_A102H
Class: oxidoreductase
Keywords: Ene-reductase Old yellow enzyme C25D_I67T_A102H, oxidoreductase
Deposited on 2017-07-13, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromate reductase
    Species: Thermus scotoductus SA-01 [TaxId:743525]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d5ogta_
  • Chain 'B':
    Compound: Chromate reductase
    Species: Thermus scotoductus SA-01 [TaxId:743525]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d5ogtb_
  • Chain 'C':
    Compound: Chromate reductase
    Species: Thermus scotoductus SA-01 [TaxId:743525]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d5ogtc_
  • Chain 'D':
    Compound: Chromate reductase
    Species: Thermus scotoductus SA-01 [TaxId:743525]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d5ogtd_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ogtA (A:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogtA (A:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ogtB (B:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogtB (B:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ogtC (C:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogtC (C:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ogtD (D:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogtD (D:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf