PDB entry 5ogp

View 5ogp on RCSB PDB site
Description: Metalacarborane inhibitors of Carbonic Anhydrase IX
Class: lyase
Keywords: Carbonic Anhydrase IX, CA Inhibitor, lyase
Deposited on 2017-07-13, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-258)
      • conflict (63)
      • conflict (65)
      • conflict (67)
      • conflict (89)
      • conflict (128)
      • conflict (201)
      • conflict (221)
    Domains in SCOPe 2.07: d5ogpa_
  • Heterogens: ZN, 9UK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ogpA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghsfqvvfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlv
    hwntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttpplaecvtwivlkepisvsseqvvkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk