PDB entry 5ogo

View 5ogo on RCSB PDB site
Description: Crystal structure of chimeric carbonic anhydrase I with 3-(Benzylamino)-2,5,6-trifluoro-4-[(2-hydroxyethyl)sulfonyl]benzenesulfonamide
Class: lyase
Keywords: drug design, carbonic anhydrase, benzenesulfonamide, metal-binding, lyase-lyase inhibitor complex, double binding, LYASE
Deposited on 2017-07-13, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: N/A
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered mutation (61)
      • engineered mutation (66)
      • engineered mutation (90)
      • engineered mutation (120)
      • engineered mutation (129)
      • engineered mutation (133)
      • engineered mutation (198)
      • engineered mutation (202)
    Domains in SCOPe 2.07: d5ogoa_
  • Heterogens: ZN, WWO, DMS, BCN, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ogoA (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nvghafhvefddsqdkavlkggpldgtyrlfqfhfhwgsldgqgsehtvdkkkyaaelhl
    ahwntkygdlgkaaqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslthpplyecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogoA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnv
    ghafhvefddsqdkavlkggpldgtyrlfqfhfhwgsldgqgsehtvdkkkyaaelhlah
    wntkygdlgkaaqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslthpplyecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk