PDB entry 5ogi

View 5ogi on RCSB PDB site
Description: Complex of a binding protein and human adenovirus C 5 hexon
Class: viral protein
Keywords: Antibody, Human Adenovirus C5, gene therapy, VIRAL PROTEIN
Deposited on 2017-07-13, released 2018-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexon protein
    Species: Human adenovirus C serotype 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04133
      • conflict (272)
      • conflict (420)
      • conflict (422-423)
      • conflict (425)
    Domains in SCOPe 2.08: d5ogia1, d5ogia2
  • Chain 'B':
    Compound: scFv of 9C12 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OGI (0-End)
    Domains in SCOPe 2.08: d5ogib1, d5ogib2, d5ogib3
  • Heterogens: SO4, DIO, EDO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ogiA (A:)
    matpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdr
    sqrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgta
    ynalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginit
    kegiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakp
    tnenggqgilvkqqngklesqvemqffstteaaagngdnltpkvvlysedvdietpdthi
    symptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvd
    lqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggv
    gnnstytkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialy
    lpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregq
    aypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogiA (A:)
    mpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrltl
    rfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynalap
    kgapnpcewdeaataeqqkthvfgqapysginitkegiqigvegqtpkyadktfqpepqi
    gesqwyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngklesqvemqf
    fstteaaagngdnltpkvvlysedvdietpdthisymptikegnsrelmgqqsmpnrpny
    iafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsm
    wnqavdsydpdvriienhgtedelpnycfplggvgnnstytkvkpktgqengwekdatef
    sdkneirvgnnfameinlnanlwrnflysnialylpdklkyspsnvkisdnpntydymnk
    rvvapglvdcyinlgarwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkf
    faiknllllpgsytyewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahnt
    astleamlrndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktk
    etpslgsgydpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeik
    rsvdgegynvaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvv
    ddtkykdyqqvgilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflc
    drtlwripfssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvv
    rvhrphrgvietvylrtpfsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ogiB (B:)
    dykddddkdivmtqspsslsasvgdrvtitckasqsvtndaawyqkkpgkapklliyqas
    trytgvpsrfsgsgygtdftltisslqpedfatyfchqdysspltfgqgtkveikrgggg
    sggggsggggsqvqlvqsgaedkkpgasvkvsckvsgfslgrygvhwvrqapgqglewmg
    viwrggttdynakfqgrvtitkddskstvymelsslrsedtavyycarqgsnfplaywgq
    gtlvtvsslevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogiB (B:)
    dykddddkdivmtqspsslsasvgdrvtitckasqsvtndaawyqkkpgkapklliyqas
    trytgvpsrfsgsgygtdftltisslqpedfatyfchqdysspltfgqgtkveikrqvql
    vqsgaedkkpgasvkvsckvsgfslgrygvhwvrqapgqglewmgviwrggttdynakfq
    grvtitkddskstvymelsslrsedtavyycarqgsnfplaywgqgtlvtvss