PDB entry 5ogh

View 5ogh on RCSB PDB site
Description: Structure of RNase A at high resolution (1.16 A) in complex with 3'-CMP and sulphate ions
Class: hydrolase
Keywords: Ribonuclease A, 3'-CMP, RNase A, mononucleotide inhibitor, high resolution, hydrolase
Deposited on 2017-07-13, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ogha_
  • Heterogens: C3P, SO4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oghA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv