PDB entry 5ogb

View 5ogb on RCSB PDB site
Description: Human Cellular Retinoic Acid Binding Protein II (CRABPII) with bound synthetic retinoid DC360.
Class: signaling protein
Keywords: Retinoid, Fluorescent, DC360, CRABPII, SIGNALING PROTEIN
Deposited on 2017-07-12, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ogba_
  • Heterogens: 9U5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ogbA (A:)
    mpnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvr
    tteinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgel
    iltmtaddvvctrvyvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogbA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllegpktswtreltndgelilt
    mtaddvvctrvyvre