PDB entry 5ofk

View 5ofk on RCSB PDB site
Description: Crystal structure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose
Class: hydrolase
Keywords: xylanase, GH10 family, cellulase, HYDROLASE
Deposited on 2017-07-11, released 2017-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 48
    Species: Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) [TaxId:521460]
    Gene: Athe_1857
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9MKT7 (3-338)
      • expression tag (0-2)
      • engineered mutation (142)
      • engineered mutation (250)
      • conflict (321)
    Domains in SCOPe 2.08: d5ofka1, d5ofka2
  • Heterogens: SO4, MPD, PIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ofkA (A:)
    dkmpdwnipslyesykndfrigvaipakclsndtdrrmvlkhfnsitaenemkpesllag
    qtstglnyrfstadtfvdfantnnigirghtlvwhsqtpdwffkdssgqrltkdallarl
    kqyiydvvgrykgkvyawdvvnqaidenqsdgyrrstwyeicgpeyiekafiwaheadpn
    aklfyndynteiskkrdfiynmvknlkskgipihgigmqchinvnwpsvseiensiklfs
    sipgieihitqldmslynygssenystppqdllqkqaqkykelftmlkkytnvvkcvtfw
    glkddyswlrsfngkndwplllfedysakpaywavieas