PDB entry 5odx

View 5odx on RCSB PDB site
Description: Crystal Structure of Hsp90-alpha N-Domain in complex with Indazole derivative
Class: chaperone
Keywords: chaperone
Deposited on 2017-07-07, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odxa_
  • Heterogens: 9RZ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5odxA (A:)
    gdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdp
    skldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagad
    ismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvi
    lhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5odxA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfvek