PDB entry 5odt

View 5odt on RCSB PDB site
Description: Aurora-A in complex with TACC3
Class: transferase
Keywords: Mitotic kinase, Transferase
Deposited on 2017-07-06, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (153)
      • engineered mutation (169)
    Domains in SCOPe 2.08: d5odta_
  • Chain 'B':
    Compound: Transforming acidic coiled-coil-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TACC3, ERIC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5odtA (A:)
    meskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkianfgwsvhapssrrttlagtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskpsnaqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5odtA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkianfgwsvhagtldylppemiegrmhdekvdlws
    lgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpml
    revlehpwitansskpsn
    

  • Chain 'B':
    No sequence available.