PDB entry 5od8

View 5od8 on RCSB PDB site
Description: Crystal structure of the RA-associated mAb B2 (Fab fragment)
Class: immune system
Keywords: antibody Fab fragment, IMMUNE SYSTEM rheumatoid arthritis associated, IMMUNE SYSTEM
Deposited on 2017-07-05, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B2 Fab fragment - heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OD8 (0-229)
    Domains in SCOPe 2.08: d5od8a_
  • Chain 'B':
    Compound: B2 Fab fragment - Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OD8 (0-End)
    Domains in SCOPe 2.08: d5od8b1, d5od8b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5od8A (A:)
    qvqlvqsgaevkkpgssvkvscrasggtfsnyviswvrqapgqglewmggiipifgtahy
    aqkfqgrvtitadaststaymelsslrsedtavyycarintspiltgyyfpgvhdywgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5od8B (B:)
    airmtqspssvsasvgdrvtitcrasqsisswlawyqqkpgkapklliysasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqansfpftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5od8B (B:)
    airmtqspssvsasvgdrvtitcrasqsisswlawyqqkpgkapklliysasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqansfpftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge