PDB entry 5od5

View 5od5 on RCSB PDB site
Description: Periplasmic binding protein CeuE complexed with a synthetic catalyst
Class: transport protein
Keywords: CeuE, mettalloenzeyme, Synthetic catalyst, sidephore, Transport protein
Deposited on 2017-07-04, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enterochelin ABC transporter substrate-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AD53_07815, BKM79_06765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P069 (1-287)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5od5a1, d5od5a2
  • Chain 'B':
    Compound: Enterochelin ABC transporter substrate-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AD53_07815, BKM79_06765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P069 (1-287)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5od5b1, d5od5b2
  • Chain 'C':
    Compound: Enterochelin ABC transporter substrate-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AD53_07815, BKM79_06765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P069 (1-287)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5od5c1, d5od5c2
  • Heterogens: FE, IR, 95B, 9RT, RIR, PO4, 7PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5od5A (A:)
    mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
    kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
    lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
    qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
    ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5od5B (B:)
    mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
    kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
    lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
    qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
    ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5od5C (C:)
    mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
    kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
    lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
    qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
    ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk