PDB entry 5od0

View 5od0 on RCSB PDB site
Description: Crystal structure of ACPA E4
Class: immune system
Keywords: anti-citrullinated protein antibody Fab fragment, IMMUNE SYSTEM
Deposited on 2017-07-04, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment of ACPA E4 - heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OD0 (0-219)
    Domains in SCOPe 2.08: d5od0h_
  • Chain 'L':
    Compound: Fab fragment of ACPA E4 - Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OD0 (0-End)
    Domains in SCOPe 2.08: d5od0l1, d5od0l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5od0H (H:)
    evqleesgpglvrpsetlslsctvsgfpmsesyfwgwirqspgkglewlgsvihtgttyy
    rpslesrltiamdpsknqvslsltsvtvadsamyycvrirggssnwldpwgpgivvtass
    akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
    lytmsssvtvpsstwpsqtvtcsvahpassttvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5od0H (H:)
    evqleesgpglvrpsetlslsctvsgfpmsesyfwgwirqspgkglewlgsvihtgttyy
    rpslesrltiamdpsknqvslsltsvtvadsamyycvrirggssnwldpwgpgivvtass
    akttppsvyplapgcgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5od0L (L:)
    esvwtqppsvsaapgqkvtiscsgddsilrsafvswyqqvpgsapklvifddrqrpsgip
    arfsgsnsgttatldiaglqrgdeadyycaawngrlsafvfgsgtkltvlgqpksspsvt
    lfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymass
    yltltarawerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5od0L (L:)
    esvwtqppsvsaapgqkvtiscsgddsilrsafvswyqqvpgsapklvifddrqrpsgip
    arfsgsnsgttatldiaglqrgdeadyycaawngrlsafvfgsgtkltvlgqpksspsvt
    lfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymass
    yltltarawerhssyscqvtheghtvekslsrad