PDB entry 5ocl

View 5ocl on RCSB PDB site
Description: Nanobody-anti-VGLUT nanobody complex
Class: immune system
Keywords: nanobody, vesicular glutamate transporter, inhibitor, IMMUNE SYSTEM
Deposited on 2017-07-03, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-llama nanobody
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (Start-117)
    Domains in SCOPe 2.07: d5ocla_
  • Chain 'B':
    Compound: anti-vglut nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (0-126)
    Domains in SCOPe 2.07: d5oclb_
  • Chain 'C':
    Compound: anti-llama nanobody
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (Start-117)
    Domains in SCOPe 2.07: d5oclc_
  • Chain 'D':
    Compound: anti-vglut nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (Start-126)
    Domains in SCOPe 2.07: d5ocld_
  • Chain 'E':
    Compound: anti-vglut nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (Start-126)
    Domains in SCOPe 2.07: d5ocle_
  • Chain 'F':
    Compound: anti-llama nanobody
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (0-117)
    Domains in SCOPe 2.07: d5oclf_
  • Chain 'G':
    Compound: anti-vglut nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (0-126)
    Domains in SCOPe 2.07: d5oclg_
  • Chain 'H':
    Compound: anti-llama nanobody
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCL (Start-117)
    Domains in SCOPe 2.07: d5oclh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oclA (A:)
    gpsqgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmt
    nyadsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oclA (A:)
    qgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmtnya
    dsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oclB (B:)
    gpsqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggn
    thyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnpsgssvyrrndywgqg
    tqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oclC (C:)
    gpsqgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmt
    nyadsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oclC (C:)
    psqgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmtn
    yadsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oclD (D:)
    gpsqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggn
    thyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnpsgssvyrrndywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oclD (D:)
    psqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggnt
    hyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnpyrrndywgqgtqvtvs
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oclE (E:)
    gpsqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggn
    thyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnpsgssvyrrndywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oclE (E:)
    psqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggnt
    hyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnrrndywgqgtqvtvss
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oclF (F:)
    gpsqgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmt
    nyadsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oclG (G:)
    gpsqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggn
    thyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnpsgssvyrrndywgqg
    tqvtvss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5oclH (H:)
    gpsqgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmt
    nyadsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oclH (H:)
    qgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmtnya
    dsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss