PDB entry 5ocg

View 5ocg on RCSB PDB site
Description: Discovery of small molecules binding to KRAS via high affinity antibody fragment competition method.
Class: hydrolase
Keywords: Domain antibodies, small molecules, drug fragment screening, HYDROLASE
Deposited on 2017-06-30, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (2-End)
      • expression tag (1)
      • variant (12)
    Domains in SCOPe 2.07: d5ocga1, d5ocga2
  • Heterogens: MG, GNP, 9R5, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ocgA (A:)
    gsteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkk
    ksktkcvim
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocgA (A:)
    steyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmsk