PDB entry 5oc8

View 5oc8 on RCSB PDB site
Description: hdm2 (17-111, wild type) complexed with nvp-hdm201 at 1.56a
Class: ligase
Keywords: ppi with p53, inhibitor complex, cell cycle, ligase
Deposited on 2017-06-29, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5oc8a_
  • Heterogens: 9QW, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5oc8A (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

    Sequence, based on observed residues (ATOM records): (download) 
    >5oc8A (A:)
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvvn