PDB entry 5obx

View 5obx on RCSB PDB site
Description: Mycoplasma genitalium DnaK-NBD
Class: chaperone
Keywords: Complex, co-factor, ATP hydrolysis, CHAPERONE
Deposited on 2017-06-29, released 2018-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein dnaK
    Species: Mycoplasma genitalium [TaxId:243273]
    Gene: dnaK, hsp70, MG305
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47547 (Start-365)
      • conflict (229)
      • expression tag (366-371)
    Domains in SCOPe 2.08: d5obxa1, d5obxa2, d5obxa3
  • Heterogens: SO4, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5obxA (A:)
    msadngliigidlgttnscvsvmeggrpvvlenpegkrttpsivsyknneiivgdaakrq
    mvtnpntivsikrlmgtsnkvkvqnadgttkelspeqvsaqilsylkdfaekkigkkisr
    avitvpayfndaernatktagkiaglnveriineptaaalaygidkasremkvlvydlgg
    gtfdvslldiaegtfevlatagdnrlggddwdnkiieyisayiakehqgknlskdkmamq
    rlkeaaerakielsaqletiislpfltvtqkgpvnvelkltrakfeeltkpllertrnpi
    sdvikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsinpdevvaigaaiqg
    gvlrgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obxA (A:)
    adngliigidlgttnscvsvmeggrpvvlenpegkrttpsivsyknneiivgdaakrqmv
    tnpntivsikrlmgtsnkvkvqnadgttkelspeqvsaqilsylkdfaekkigkkisrav
    itvpayfndaernatktagkiaglnveriineptaaalaygidkasremkvlvydlgggt
    fdvslldiaegtfevlatagdnrlggddwdnkiieyisayiakehqgknlskdkmamqrl
    keaaerakielsaqletiislpfltvtqkgpvnvelkltrakfeeltkpllertrnpisd
    vikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsinpdevvaigaaiqggv
    lrgdlehhhh