PDB entry 5obj

View 5obj on RCSB PDB site
Description: Aurora A kinase in complex with 2-(3-fluorophenyl)quinoline-4-carboxylic acid and ATP
Class: cell cycle
Keywords: inhibitor, kinase, allostery, protein-protein interface, CELL CYCLE
Deposited on 2017-06-28, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5obja_
  • Heterogens: MG, SO4, ATP, 9QK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5objA (A:)
    gsmgskrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyite
    lanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardl
    isrllkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5objA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhapssrcgtldylppemiegrmhdekv
    dlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsq
    rpmlrevlehpwitansskp