PDB entry 5obh

View 5obh on RCSB PDB site
Description: Crystal structure of glycine binding protein in complex with bicuculline
Class: signaling protein
Keywords: receptor, acetylcholine binding, SIGNALING PROTEIN
Deposited on 2017-06-27, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • engineered mutation (205-208)
    Domains in SCOPe 2.07: d5obha_
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d5obhb_
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d5obhc_
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • engineered mutation (205)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d5obhd_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d5obhe_
  • Heterogens: J94, CL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5obhA (A:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhykgtgepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obhA (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhykgtgepyidvnlvvkfrerra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5obhB (B:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhykgtgepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obhB (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhygepyidvnlvvkfrerr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5obhC (C:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhykgtgepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obhC (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhygepyidvnlvvkfrerragn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5obhD (D:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhykgtgepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obhD (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhykgepyidvnlvvkfrerr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5obhE (E:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhykgtgepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obhE (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhygepyidvnlvvkfrerrag