SCOPe 2.08: Structural Classification of Proteins

PDB entry 5obb

View 5obb on RCSB PDB site
Description: Structure of a modified mouse H chain ferritin with a lanthanide binding motif in complex with Terbium
Class: metal transport
Keywords: ferritin, lanthanide, terbium, metal transport
Deposited on 2017-06-26, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obba1, d5obba2
Chain 'B':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbb1, d5obbb2
Chain 'C':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
Domains in SCOPe 2.08: d5obbc_
Chain 'D':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
Domains in SCOPe 2.08: d5obbd_
Chain 'E':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
Domains in SCOPe 2.08: d5obbe_
Chain 'F':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbf1, d5obbf2
Chain 'G':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbg1, d5obbg2
Chain 'H':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbh1, d5obbh2
Chain 'I':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbi1, d5obbi2
Chain 'J':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbj1, d5obbj2
Chain 'K':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbk1, d5obbk2
Chain 'L':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177-178)
Domains in SCOPe 2.08: d5obbl1, d5obbl2
Chain 'M':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177-178)
Domains in SCOPe 2.08: d5obbm1, d5obbm2
Chain 'N':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
Domains in SCOPe 2.08: d5obbn_
Chain 'O':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbo1, d5obbo2
Chain 'P':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbp1, d5obbp2
Chain 'Q':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177-178)
Domains in SCOPe 2.08: d5obbq1, d5obbq2
Chain 'R':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbr1, d5obbr2
Chain 'S':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177-178)
Domains in SCOPe 2.08: d5obbs1, d5obbs2
Chain 'T':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177-179)
Domains in SCOPe 2.08: d5obbt1, d5obbt2
Chain 'U':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbu1, d5obbu2
Chain 'V':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbv1, d5obbv2
Chain 'W':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177)
Domains in SCOPe 2.08: d5obbw1, d5obbw2
Chain 'X':
Compound: ferritin heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Fth1, Fth
Database cross-references and differences (RAF-indexed):
- Uniprot P09528 (Start-176)
  - expression tag (177-178)
Domains in SCOPe 2.08: d5obbx1, d5obbx2
Heterogens: TB, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5obbA (A:)
mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
yidtnndgwiegdella