PDB entry 5obb

View 5obb on RCSB PDB site
Description: Structure of a modified mouse H chain ferritin with a lanthanide binding motif in complex with Terbium
Class: metal transport
Keywords: ferritin, lanthanide, terbium, metal transport
Deposited on 2017-06-26, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obba1, d5obba2
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbb1, d5obbb2
  • Chain 'C':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obbc_
  • Chain 'D':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obbd_
  • Chain 'E':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obbe_
  • Chain 'F':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbf1, d5obbf2
  • Chain 'G':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbg1, d5obbg2
  • Chain 'H':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbh1, d5obbh2
  • Chain 'I':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbi1, d5obbi2
  • Chain 'J':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbj1, d5obbj2
  • Chain 'K':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbk1, d5obbk2
  • Chain 'L':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177-178)
    Domains in SCOPe 2.07: d5obbl1, d5obbl2
  • Chain 'M':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177-178)
    Domains in SCOPe 2.07: d5obbm1, d5obbm2
  • Chain 'N':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obbn_
  • Chain 'O':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbo1, d5obbo2
  • Chain 'P':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbp1, d5obbp2
  • Chain 'Q':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177-178)
    Domains in SCOPe 2.07: d5obbq1, d5obbq2
  • Chain 'R':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbr1, d5obbr2
  • Chain 'S':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177-178)
    Domains in SCOPe 2.07: d5obbs1, d5obbs2
  • Chain 'T':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177-179)
    Domains in SCOPe 2.07: d5obbt1, d5obbt2
  • Chain 'U':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbu1, d5obbu2
  • Chain 'V':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbv1, d5obbv2
  • Chain 'W':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obbw1, d5obbw2
  • Chain 'X':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177-178)
    Domains in SCOPe 2.07: d5obbx1, d5obbx2
  • Heterogens: TB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5obbA (A:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbA (A:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5obbB (B:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbB (B:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5obbC (C:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbC (C:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5obbD (D:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbD (D:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5obbE (E:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbE (E:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5obbF (F:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbF (F:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5obbG (G:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbG (G:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5obbH (H:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbH (H:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5obbI (I:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbI (I:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5obbJ (J:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbJ (J:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5obbK (K:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbK (K:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5obbL (L:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbL (L:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5obbM (M:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbM (M:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggs
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5obbN (N:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbN (N:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5obbO (O:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbO (O:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5obbP (P:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbP (P:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5obbQ (Q:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbQ (Q:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggs
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5obbR (R:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbR (R:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5obbS (S:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbS (S:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggs
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5obbT (T:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbT (T:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5obbU (U:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbU (U:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5obbV (V:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbV (V:)
    sqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheereh
    aeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdkn
    dphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5obbW (W:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbW (W:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5obbX (X:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obbX (X:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggs