PDB entry 5oba

View 5oba on RCSB PDB site
Description: Structure of a modified mouse H-chain ferritin with a lanthanide binding motif
Class: metal transport
Keywords: ferritin, lanthanide, metal transport
Deposited on 2017-06-26, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obaa_
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obab_
  • Chain 'C':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obac_
  • Chain 'D':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obad_
  • Chain 'E':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obae_
  • Chain 'F':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obaf1, d5obaf2
  • Chain 'G':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obag1, d5obag2
  • Chain 'H':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obah_
  • Chain 'I':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obai_
  • Chain 'J':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obaj_
  • Chain 'K':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obak_
  • Chain 'L':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obal1, d5obal2
  • Chain 'M':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obam_
  • Chain 'N':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oban_
  • Chain 'O':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obao_
  • Chain 'P':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obap_
  • Chain 'Q':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obaq_
  • Chain 'R':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obar1, d5obar2
  • Chain 'S':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obas1, d5obas2
  • Chain 'T':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obat_
  • Chain 'U':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obau_
  • Chain 'V':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obav1, d5obav2
  • Chain 'W':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obaw_
  • Chain 'X':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09528 (Start-176)
      • expression tag (177)
    Domains in SCOPe 2.07: d5obax1, d5obax2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5obaA (A:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaA (A:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5obaB (B:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaB (B:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5obaC (C:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaC (C:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5obaD (D:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaD (D:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5obaE (E:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaE (E:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5obaF (F:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaF (F:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5obaG (G:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaG (G:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5obaH (H:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaH (H:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5obaI (I:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaI (I:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5obaJ (J:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaJ (J:)
    sqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheereh
    aeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdkn
    dphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5obaK (K:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaK (K:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5obaL (L:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaL (L:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5obaM (M:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaM (M:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5obaN (N:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaN (N:)
    sqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheereh
    aeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdkn
    dphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5obaO (O:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaO (O:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5obaP (P:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaP (P:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5obaQ (Q:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaQ (Q:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5obaR (R:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaR (R:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5obaS (S:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaS (S:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5obaT (T:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaT (T:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5obaU (U:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaU (U:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5obaV (V:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaV (V:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5obaW (W:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaW (W:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5obaX (X:)
    mttaspsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhk
    latdkndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlggsg
    yidtnndgwiegdella
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obaX (X:)
    spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
    kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgg