PDB entry 5ob5

View 5ob5 on RCSB PDB site
Description: fAb complex with GroBeta. AbVance: increasing our knowledge of antibody structural space to enable faster and better decision-making in antibody drug discovery.
Class: immune system
Keywords: fAb complex, AbVance project, Pistoia Alliance, immune system
Deposited on 2017-06-26, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-X-C motif chemokine 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL2, GRO2, GROB, MIP2A, SCYB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ob5a_
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OB5 (0-219)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OB5 (0-212)
    Domains in SCOPe 2.06: d5ob5l1, d5ob5l2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ob5A (A:)
elrcqclqtlqgihlkniqsvkvkspgphcaqteviatlkngqkaclnpaspmvkkiiek
mlk

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ob5L (L:)
diqmtqspsslsasvgdrvtitcqasqdiesylswyqqkpgkapklliyyatrladgvps
rfsgsgsgqdytltisslqpedfatyyclqhgespptfgqgtkleikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge