PDB entry 5oax

View 5oax on RCSB PDB site
Description: Galectin-3c in complex with thiogalactoside derivate
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2017-06-25, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (1-137)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5oaxa1, d5oaxa2
  • Heterogens: 9Q5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oaxA (A:)
    mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
    cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
    klgisgdidltsasytmi