PDB entry 5oau

View 5oau on RCSB PDB site
Description: Penicillin-Binding Protein 2X (PBP2X) from Streptococcus pneumoniae
Class: antibiotic
Keywords: Penicillin, b-lactam, cell-wall, transpeptidase, ANTIBIOTIC
Deposited on 2017-06-23, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 2x
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: pbpX, spr0304
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5oaua1, d5oaua2, d5oaua3, d5oaua4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oauA (A:)
    gtgtrfgtdlakeakkvhqttrtvpakrgtiydrngvpiaedatsynvyavidenyksat
    gkilyvektqfnkvaevfhkyldmeesyvreqlsqpnlkqvsfgakgngityanmmsikk
    eleaaevkgidfttspnrsypngqfassfiglaqlhenedgsksllgtsgmesslnsila
    gtdgiityekdrlgnivpgteqvsqrtmdgkdvyttissplqsfmetqmdafqekvkgky
    mtatlvsaktgeilattqrptfdadtkegitedfvwrdilyqsnyepgstmkvmmlaaai
    dnntfpggevfnsselkiadatirdwdvnegltggrmmtfsqgfahssnvgmtlleqkmg
    datwldylnrfkfgvptrfgltdeyagqlpadnivniaqssfgqgisvtqtqmiraftai
    andgvmlepkfisaiydpndqtarksqkeivgnpvskdaasltrtnmvlvgtdpvygtmy
    nhstgkptvtvpgqnvalksgtaqiadeknggylvgltdyifsavsmspaenpdfilyvt
    vqqpehysgiqlgefanpilerasamkdslnlqttakaleqvsqqspypmpsvkdispgd
    laeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsdkaeevpdmygwtketae
    tlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oauA (A:)
    hqttrtvpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaev
    fhkyldmeesyvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspn
    rsypngqfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekpgteqvs
    qrtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfda
    dtkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatir
    dwdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltde
    yagqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtar
    ksqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaq
    iatdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
    akaleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapn
    qqvlilsdkaeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikk
    itltlgd