PDB entry 5oaj

View 5oaj on RCSB PDB site
Description: Crystal structure of mutant AChBP in complex with tropisetron (T53F, Q74R, Y110A, I135S, G162E)
Class: signaling protein
Keywords: receptor, acetylcholine binding, SIGNALING PROTEIN
Deposited on 2017-06-22, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oaja_
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (Start-235)
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • expression tag (236-241)
      • expression tag (243-246)
    Domains in SCOPe 2.07: d5oajb1, d5oajb2
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oajc_
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oajd_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oaje_
  • Chain 'F':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oajf_
  • Chain 'G':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oajg_
  • Chain 'H':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oajh_
  • Chain 'I':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d5oaji_
  • Chain 'J':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (Start-235)
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (161)
      • expression tag (236-240)
    Domains in SCOPe 2.07: d5oajj1, d5oajj2
  • Heterogens: TKT, NAG, EDO, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oajA (A:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajA (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oajB (B:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajB (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerranlfdenlyfqhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oajC (C:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajC (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oajD (D:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajD (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oajE (E:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajE (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5oajF (F:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajF (F:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5oajG (G:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajG (G:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5oajH (H:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajH (H:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5oajI (I:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajI (I:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5oajJ (J:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oajJ (J:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerrfdenlyf