PDB entry 5oai

View 5oai on RCSB PDB site
Description: Structure of MDM2 with low molecular weight inhibitor
Class: ligase
Keywords: p53, MDM2, MDMX, protein-protein interaction, cancer, inhibitor, ligase
Deposited on 2017-06-22, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5oaia_
  • Heterogens: B5K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oaiA (A:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqq