PDB entry 5oah

View 5oah on RCSB PDB site
Description: THE PERIPLASMIC BINDING PROTEIN CEUE OF CAMPYLOBACTER JEJUNI BINDS THE IRON(III) COMPLEX OF Azotochelin
Class: metal binding protein
Keywords: metal binding protein, iron uptake, tetradentate siderophore binding protein, azotochelin
Deposited on 2017-06-22, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enterochelin ABC transporter substrate-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AD53_07815, BKM79_06765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P069 (1-287)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5oaha1, d5oaha2
  • Chain 'B':
    Compound: Enterochelin ABC transporter substrate-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AD53_07815, BKM79_06765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P069 (1-287)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5oahb_
  • Chain 'C':
    Compound: Enterochelin ABC transporter substrate-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AD53_07815, BKM79_06765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P069 (1-287)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5oahc1, d5oahc2
  • Heterogens: FE, 95B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oahA (A:)
    mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
    kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
    lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
    qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
    ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oahB (B:)
    mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
    kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
    lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
    qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
    ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oahC (C:)
    mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
    kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
    lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
    qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
    ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk