PDB entry 5oa0

View 5oa0 on RCSB PDB site
Description: Crystal structure of mutant AChBP in complex with strychnine (T53F, Q74R, Y110A, I135S, W164F)
Class: signaling protein
Keywords: receptor, acetylcholine binding, SIGNALING PROTEIN
Deposited on 2017-06-20, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d5oa0a_
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d5oa0b_
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d5oa0c_
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d5oa0d_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • engineered mutation (52)
      • conflict (59)
      • engineered mutation (73)
      • engineered mutation (109)
      • engineered mutation (134)
      • conflict (154)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d5oa0e_
  • Heterogens: SY9, NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oa0A (A:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oa0A (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oa0B (B:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oa0B (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oa0C (C:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oa0C (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oa0D (D:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oa0D (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oa0E (E:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkv
    dsstnevdlvyyerqrwklnslmwdpneygnitdfrtsaadiwtpditaasstrpvqvls
    pqiavvthdgsvmfspaqrlsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oa0E (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
    lsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngf