PDB entry 5o9b

View 5o9b on RCSB PDB site
Description: Solution NMR structure of human GATA2 C-terminal zinc finger domain
Class: transcription
Keywords: GATA, Transcription factor, Haematopoeisis, transcription
Deposited on 2017-06-16, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial transcription factor GATA-2
    Species: Homo sapiens [TaxId:9606]
    Gene: GATA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23769 (19-67)
      • initiating methionine (0)
      • expression tag (1-18)
    Domains in SCOPe 2.07: d5o9ba_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o9bA (A:)
    mahhhhhhssglevlfqgprragtccancqtttttlwrrnangdpvcnacglyyklhnvn
    rpltmkke