PDB entry 5o96

View 5o96 on RCSB PDB site
Description: Structure of the putative methyltransferase Lpg2936 from Legionella pneumophila in complex with the bound cofactor SAM
Class: transferase
Keywords: RNA methyltransferase, RsmE-like, SAM, S-adenosylmethionine, TRANSFERASE
Deposited on 2017-06-15, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96a1, d5o96a2
  • Chain 'B':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96b1, d5o96b2
  • Chain 'C':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96c1, d5o96c2
  • Chain 'D':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96d1, d5o96d2
  • Chain 'E':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96e1, d5o96e2
  • Chain 'F':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96f1, d5o96f2
  • Chain 'G':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96g1, d5o96g2
  • Chain 'H':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o96h1, d5o96h2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o96A (A:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96A (A:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o96B (B:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96B (B:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o96C (C:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96C (C:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o96D (D:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96D (D:)
    avrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkk
    kqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvki
    dkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktw
    rdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaag
    gdl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5o96E (E:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96E (E:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5o96F (F:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96F (F:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5o96G (G:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96G (G:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5o96H (H:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o96H (H:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl