PDB entry 5o95

View 5o95 on RCSB PDB site
Description: Structure of the putative methyltransferase Lpg2936 from Legionella pneumophila
Class: transferase
Keywords: RNA methyltransferase, RsmE-like, TRANSFERASE
Deposited on 2017-06-15, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5o95a1, d5o95a2
  • Chain 'B':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRE6 (2-244)
      • expression tag (1)
    Domains in SCOPe 2.06: d5o95b1, d5o95b2, d5o95b3
  • Chain 'C':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRE6 (2-244)
      • expression tag (1)
    Domains in SCOPe 2.06: d5o95c1, d5o95c2, d5o95c3
  • Chain 'D':
    Compound: Ribosomal RNA small subunit methyltransferase E
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpg2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5o95d1, d5o95d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o95A (A:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o95A (A:)
    vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
    qvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkid
    kekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwr
    dypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaagg
    dl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o95B (B:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o95B (B:)
    pavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervk
    kkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvk
    idkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafskt
    wrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaa
    ggdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o95C (C:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o95C (C:)
    pavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervk
    kkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvk
    idkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafskt
    wrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaa
    ggdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o95D (D:)
    gpavrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasierv
    kkkqvfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqv
    kidkekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsk
    twrdypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqa
    aggdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o95D (D:)
    rtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkkq
    vfvriasvlevnresplkihlaqaiskgermemvmqksaelgvacitplitercqvkidk
    ekmakkmhqwlniiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwrd
    ypvqppdvaliigpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaaggd
    l