PDB entry 5o8g

View 5o8g on RCSB PDB site
Description: Crystal structure of human histidine triad nucleotide-binding protein 1 (hHINT1) crystallized at P212121 space group, with visible extended fragment of N-terminus
Class: hydrolase
Keywords: phosphoramidase, desulfurase, tumour suppressor, HYDROLASE
Deposited on 2017-06-13, released 2017-06-28
Made obsolete by 6g9z on 2018-04-18

The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT, PKCI1, PRKCNH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o8ga_
  • Chain 'B':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT, PKCI1, PRKCNH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o8gb_
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o8gA (A:)
    madeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhi
    sqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrq
    mhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o8gA (A:)
    iakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqis
    vaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwp
    pg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o8gB (B:)
    madeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhi
    sqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrq
    mhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o8gB (B:)
    arpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddd
    esllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg