PDB entry 5o87

View 5o87 on RCSB PDB site
Description: Crystal structure of wild type Aplysia californica AChBP in complex with nicotine
Class: signaling protein
Keywords: receptor, SIGNALING PROTEIN
Deposited on 2017-06-12, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87a_
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87b_
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87c_
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87d_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87e_
  • Chain 'F':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87f_
  • Chain 'G':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87g_
  • Chain 'H':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87h_
  • Chain 'I':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87i_
  • Chain 'J':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (154)
    Domains in SCOPe 2.07: d5o87j_
  • Heterogens: NCT, NAG, EDO, PO4, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o87A (A:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87A (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o87B (B:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87B (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o87C (C:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87C (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o87D (D:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87D (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5o87E (E:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87E (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5o87F (F:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87F (F:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5o87G (G:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87G (G:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5o87H (H:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87H (H:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5o87I (I:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87I (I:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5o87J (J:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o87J (J:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr