PDB entry 5o7n

View 5o7n on RCSB PDB site
Description: Beta-lactamase VIM-2 in complex with (2R)-1-(2-Benzyl-3-mercaptopropanoyl)piperidine-2-carboxylic acid
Class: hydrolase
Keywords: Inhibitor, Complex, MBL, Beta-lactamase VIM-2, (2R)-1-(2-Benzyl-3-mercaptopropanoyl)piperidine-2-carboxylic acid, Hydrolase
Deposited on 2017-06-09, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase vim-2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaVIM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o7na_
  • Chain 'B':
    Compound: beta-lactamase vim-2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaVIM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o7nb_
  • Heterogens: ZN, 9NK, FMT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o7nA (A:)
    mhhhhhhenlyfqgvdssgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsngl
    ivrdgdelllidtawgakntaallaeiekqiglpvtravsthfhddrvggvdvlraagva
    tyaspstrrlaevegneipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsas
    vlyggcaiyelsrtsagnvadadlaewptsieriqqhypeaqfvipghglpggldllkht
    tnvvkahtnrsvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o7nA (A:)
    geypteipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgaknt
    aallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneipt
    hsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnva
    dadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o7nB (B:)
    mhhhhhhenlyfqgvdssgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsngl
    ivrdgdelllidtawgakntaallaeiekqiglpvtravsthfhddrvggvdvlraagva
    tyaspstrrlaevegneipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsas
    vlyggcaiyelsrtsagnvadadlaewptsieriqqhypeaqfvipghglpggldllkht
    tnvvkahtnrsvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o7nB (B:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs