PDB entry 5o7i

View 5o7i on RCSB PDB site
Description: ERK5 in complex with a pyrrole inhibitor
Class: transferase
Keywords: KINASE, INHIBITOR, PYRROLE, transferase
Deposited on 2017-06-08, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK7, BMK1, ERK5, PRKM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o7ia_
  • Heterogens: 9N8, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o7iA (A:)
    gdvtfdvgdeyeiietigngaygvvssarrrltgqqvaikkipnafdvvtnakrtlrelk
    ilkhfkhdniiaikdilrptvpygefksvyvvldlmesdlhqiihssqpltlehvryfly
    qllrglkymhsaqvihrdlkpsnllvnencelkigdfgmarglctspaehqyfmteyvat
    rwyrapelmlslheytqaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspa
    viqavgaervrayiqslpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrh
    pflakyhdpddepdcappfdfafdrealtrerikeaivaeiedfharregirqqirfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o7iA (A:)
    eyeiietigngaygvvssarrrltgqqvaikkipnafdvvtnakrtlrelkilkhfkhdn
    iiaikdilrptvpygefksvyvvldlmesdlhqiihssqpltlehvryflyqllrglkym
    hsaqvihrdlkpsnllvnencelkigdfgmarglctspaehqyfmteyvatrwyrapelm
    lslheytqaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaer
    vrayiqslpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdp
    ddepdcappfdfafdrealtrerikeaivaeiedfharre