PDB entry 5o79

View 5o79 on RCSB PDB site
Description: Klebsiella pneumoniae OmpK36
Class: membrane protein
Keywords: Outer membrane protein, porin, ion transport, OmpC ortholog, MEMBRANE PROTEIN
Deposited on 2017-06-08, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ompk36
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ompK36
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6QLY0 (0-343)
      • conflict (234)
    Domains in SCOPe 2.07: d5o79a_
  • Chain 'B':
    Compound: ompk36
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ompK36
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6QLY0 (0-343)
      • conflict (234)
    Domains in SCOPe 2.07: d5o79b_
  • Chain 'C':
    Compound: ompk36
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ompK36
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6QLY0 (0-343)
      • conflict (234)
    Domains in SCOPe 2.07: d5o79c_
  • Heterogens: C8E, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o79A (A:)
    aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
    qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
    flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
    ltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqty
    natragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvga
    tyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o79A (A:)
    aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
    qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
    flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
    ltydgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqtynat
    ragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvgatyy
    fnknmstyvdykinllddnsftrnagistddvvalglvyqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o79B (B:)
    aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
    qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
    flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
    ltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqty
    natragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvga
    tyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o79C (C:)
    aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
    qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
    flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
    ltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqty
    natragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvga
    tyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o79C (C:)
    aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
    qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
    flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
    ltydigisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasrytqtyna
    tragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvgaty
    yfnknmstyvdykinllddnsftrnagistddvvalglvyqf