PDB entry 5o6j

View 5o6j on RCSB PDB site
Description: Human NMT1 in complex with myristoyl-CoA and inhibitor IMP-1031
Class: transferase
Keywords: Myristoyl, transferase, inhibitor
Deposited on 2017-06-06, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o6ja1, d5o6ja2
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o6jb1, d5o6jb2
  • Heterogens: MYA, PO4, MG, 9M8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o6jA (A:)
    gphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgd
    rgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgf
    isaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagv
    vlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkd
    ipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlps
    timnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktflekl
    kfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6jA (A:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    rywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqllt
    rylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthk
    slkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnl
    qyylynwkcpsmgaekvglvlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o6jB (B:)
    gphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgd
    rgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgf
    isaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagv
    vlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkd
    ipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlps
    timnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktflekl
    kfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6jB (B:)
    krsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkely
    tllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipani
    hiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgt
    crywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqll
    trylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpth
    kslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgn
    lqyylynwkcpsmgaekvglvlq