PDB entry 5o55

View 5o55 on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with BZ047
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA binding protein
Deposited on 2017-05-31, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peregrin
  Species: Homo sapiens [TaxId:9606]
  Gene: BRPF1, BR140
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55201
  Domains in SCOPe 2.08: d5o55a_
• Heterogens: NO3, 9L5, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5o55A (A:)
  smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
  yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5o55A (A:)
  emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
  ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm