PDB entry 5o48

View 5o48 on RCSB PDB site
Description: P.vivax NMT with an aminomethylindazole inhibitor bound
Class: transferase
Keywords: transferase, inhibitor, myristoyl
Deposited on 2017-05-26, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVX_085815
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o48a1
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVX_085815
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o48b1
  • Chain 'C':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVX_085815
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o48c1
  • Heterogens: NHW, 9K2, DMS, MG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o48A (A:)
    idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
    eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
    tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
    vsdaryyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvh
    kllgsyleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgnd
    kystlnaaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegd
    gslkyylynwkcasfapahvgivll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o48B (B:)
    idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
    eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
    tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
    vsdaryyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvh
    kllgsyleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgnd
    kystlnaaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegd
    gslkyylynwkcasfapahvgivll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o48C (C:)
    idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
    eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
    tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
    vsdaryyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvh
    kllgsyleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgnd
    kystlnaaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegd
    gslkyylynwkcasfapahvgivll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o48C (C:)
    dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
    iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
    dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
    sdaryyhrsinvkklieigfsvedtlniknmrlmkkkdvegvhkllgsyleqfnlyavft
    keeiahwflpienviytyvneengkikdmisfyslpsqilgndkystlnaaysfynvttt
    atfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslkyylynwkcasfap
    ahvgivll